Antibodies

Jump to Filters
View as table Download
Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
TA812796

USD 447.00

In Stock

KARS mouse monoclonal antibody,clone OTI1E7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
CF812796

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) KARS mouse monoclonal antibody,clone OTI1E7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
TA812796S

USD 200.00

2 Days

KARS mouse monoclonal antibody,clone OTI1E7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody
TA350109

USD 380.00

In Stock

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KARS
Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody
TA345923

USD 539.00

5 Days

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV