Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
Rabbit Polyclonal Anti-FADS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the C terminal of human FADS1. Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL |
Rabbit Polyclonal Anti-ELOVL5 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Turkey, Chicken (100%); Elephant, Catfish (93%); Mouse, Rat, Dog, Hamster, Horse, Rabbit, Opossum, Platypus (87%); Bovine, Goat, Panda, Xenopus, Salmon (80%). |
SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3. |
FADS2 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FADS2 |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Biosynthesis of unsaturated fatty acids