Antibodies

View as table Download

Rabbit Polyclonal Anti-USE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: ARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKS

Rabbit Polyclonal Anti-STX7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STX7

Rabbit Polyclonal Anti-MDS032 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE

Rabbit Polyclonal Anti-STX1A Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Horse, Xenopus)
Conjugation Unconjugated
Immunogen STX1A / Syntaxin 1A antibody was raised against synthetic 16 amino acid peptide from internal region of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Pig, Opossum, Turkey, Chicken (100%); Horse, Xenopus (94%); Gibbon, Sheep, Zebra finch, Salmon, Stickleback, Pufferfish, Zebrafish, Ant, Water flea (88%); Beetle (81%).