Rabbit Polyclonal Anti-TROVE2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS |
Rabbit Polyclonal Anti-TROVE2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR |
CD80 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SSB rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 331-380 of Human SSB. |
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
