Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV |
Rabbit anti-NFKBIB Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NFKBIB |
Germany
Japan
United Kingdom
China
