Antibodies

Jump to Filters
View as table Download
Leptin (LEP) (N-term) Rabbit Polyclonal Antibody
AP52465PU-N

USD 580.00

2 Weeks

Leptin (LEP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 7-37 amino acids from the N-terminal region of Human Leptin.
Leptin (LEP) Rabbit Polyclonal Antibody
TA328367

USD 314.00

In Stock

Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Leptin
Leptin (LEP) Rabbit Polyclonal Antibody
TA350133

USD 380.00

In Stock

Rabbit Polyclonal Anti-LEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Leptin (LEP) Rabbit Polyclonal Antibody
TA346170

USD 539.00

5 Days

Rabbit Polyclonal Anti-LEP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
Leptin (LEP) Rabbit Polyclonal Antibody
AP20617PU-N

USD 465.00

3 Weeks

Leptin (LEP) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Leptin (LEP) Rabbit Polyclonal Antibody
TA332832

USD 365.00

3 Weeks

Rabbit anti-LEP Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LEP