Antibodies

Jump to Filters
View as table Download
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA334682

USD 485.00

5 Days

Rabbit Polyclonal Anti-PTHLH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA321532

USD 380.00

In Stock

Anti-PTHLH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA321533

USD 380.00

In Stock

Anti-PTHLH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA334683

USD 539.00

5 Days

Rabbit Polyclonal Anti-Pthlh Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pthlh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK