Anti-TFPI2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 23-235 amino acids of human tissue factor pathway inhibitor 2 |
Anti-TFPI2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 23-235 amino acids of human tissue factor pathway inhibitor 2 |
Anti-TFPI2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 23-235 amino acids of human tissue factor pathway inhibitor 2 |
Rabbit Polyclonal Anti-TFPI2 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT |
TFPI2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the Middle region of human TFPI2 |