Antibodies

Jump to Filters
View as table Download
ATF6 Rabbit Polyclonal Antibody
TA326767

USD 365.00

3 Weeks

ATF6 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human ATF6
ATF6 (Center) Rabbit Polyclonal Antibody
AP17892PU-N

USD 580.00

2 Weeks

ATF6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 356~386 amino acids from the Center region of Human ATF6.
Atf6 Rabbit Polyclonal Antibody
TA330233

USD 539.00

5 Days

Rabbit Polyclonal Anti-Atf6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Atf6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST