Rabbit polyclonal Anti-RAB5A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Rabbit polyclonal Anti-RAB5B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE |
CLTC / Clathrin Heavy Chain Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Zebrafish, Gibbon, Horse |
| Conjugation | Unconjugated |
| Immunogen | CLTC / Clathrin Heavy Chain antibody was raised against synthetic peptide C-ESLRKEEEQATETQ from an internal region (near C-terminus) of human CLTC (NP_004850.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (93%); Pufferfish (86%). |
Germany
Japan
United Kingdom
China
