Antibodies

Jump to Filters
View as table Download
CRMP1 Rabbit Polyclonal Antibody
TA321326

USD 380.00

In Stock

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 507-522 amino acids of Human collapsin response mediator protein 1
CRMP1 Rabbit Polyclonal Antibody
TA323438

USD 380.00

In Stock

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 249 amino acids of human collapsin response mediator protein 1
CRMP1 Rabbit Polyclonal Antibody
TA323437

USD 380.00

In Stock

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 249 amino acids of human collapsin response mediator protein 1
CRMP1 Rabbit Polyclonal Antibody
TA306259

USD 570.00

In Stock

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human CRMP1.
CRMP1 Rabbit Polyclonal Antibody
TA306707

USD 570.00

5 Days

Rabbit Polyclonal CRMP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRMP1 antibody was raised against a 18 amino acid peptide from near the amino terminus of human CRMP1.
CRMP1 Rabbit Polyclonal Antibody
TA323439

USD 380.00

4 Weeks

Anti-CRMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 506-522 amino acids of Human Collapsin response mediator protein 1
CRMP1 Rabbit Polyclonal Antibody
TA346284

USD 539.00

5 Days

Rabbit Polyclonal Anti-CRMP1 Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV