Rabbit Polyclonal Anti-PDIA6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIA6 antibody: synthetic peptide directed towards the middle region of human PDIA6. Synthetic peptide located within the following region: KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA |
Rabbit Polyclonal Anti-PDIA6 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIA6 antibody: synthetic peptide directed towards the N terminal of human PDIA6. Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS |
PDIA6 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human PDIA6 (NP_005733.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
