Antibodies

Jump to Filters
View as table Download
AKR1D1 Rabbit Polyclonal Antibody
TA324084

USD 380.00

In Stock

Anti-AKR1D1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
AKR1D1 Rabbit Polyclonal Antibody
TA324085

USD 380.00

In Stock

Anti-AKR1D1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
HSD11B1 Rabbit Polyclonal Antibody
TA312234

USD 380.00

In Stock

Rabbit polyclonal anti-HSD11B1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HSD11B1.
CYP11A1 Rabbit Polyclonal Antibody
TA327150

USD 365.00

3 Weeks

CYP11A1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP11A1
HSD11B1 Rabbit Polyclonal Antibody
TA338149

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD11B1 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI