Rabbit Polyclonal Anti-FADS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FADS1 |
Rabbit Polyclonal Anti-FADS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FADS1 |
Rabbit Polyclonal Anti-FADS1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the C terminal of human FADS1. Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL |