Antibodies

Jump to Filters
View as table Download
Grp75 (HSPA9) Rabbit Polyclonal Antibody
TA329128

USD 539.00

5 Days

Rabbit Polyclonal anti-HSPA9 antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
Grp75 (HSPA9) Rabbit Polyclonal Antibody
TA350037

USD 380.00

In Stock

Rabbit Polyclonal Anti-HSPA9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA9
Grp75 (HSPA9) Rabbit Polyclonal Antibody
TA326841

USD 365.00

3 Weeks

Rabbit anti-HSPA9 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA9