Rabbit Polyclonal Anti-BMP2K Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP2K antibody: synthetic peptide directed towards the C terminal of human BMP2K. Synthetic peptide located within the following region: AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV |
BMP2K Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Gibbon (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | BMP2K / BIKE antibody was raised against synthetic 15 amino acid peptide from N-terminus of human BMP2K. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Mouse (93%); Chicken, Zebrafish (87%). |
Germany
Japan
United Kingdom
China
