Antibodies

Jump to Filters
View as table Download
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA321675

USD 380.00

In Stock

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA321676

USD 380.00

4 Weeks

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA327232

USD 365.00

3 Weeks

Rabbit anti-PRDX6 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX6
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA346592

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Peroxiredoxin 6 (PRDX6) (C-term) Rabbit Polyclonal Antibody
AP17665PU-N

USD 580.00

2 Weeks

Peroxiredoxin 6 (PRDX6) (C-term) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PRDX6.