Antibodies

Jump to Filters
View as table Download
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA335033

USD 539.00

5 Days

Rabbit Polyclonal Anti-FTH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FTH1 antibody: synthetic peptide directed towards the middle region of human FTH1. Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA321425

USD 380.00

2 Weeks

Anti-FTH1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA321426

USD 380.00

2 Weeks

Anti-FTH1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA326948

USD 365.00

3 Weeks

Rabbit anti-FTH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FTH1
Ferritin Heavy Chain (FTH1) Goat Polyclonal Antibody
TA305637

USD 520.00

5 Days

Goat Anti-FTH1 Antibody

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKHTLGDSDNES, from the C Terminus of the protein sequence according to NP_002023.2.