Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Anti-SRC Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 270-523 amino acids of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Anti-SRC Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 270-523 amino acids of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) |
Germany
Japan
United Kingdom
China
