Anti-RBMS1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 392-404 amino acids of Human RNA binding motif, single stranded interacting protein 1 |
Rabbit Polyclonal Anti-RBMS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBMS1 antibody: synthetic peptide directed towards the C terminal of human RBMS1. Synthetic peptide located within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ |
RBMS1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RBMS1 (NP_002888.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
