Anti-PTGDS Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain) |
Anti-PTGDS Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain) |
Rabbit Polyclonal Anti-PTGDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS |
Germany
Japan
United Kingdom
China
