Rabbit Polyclonal Anti-SLIT1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLIT1 |
Rabbit Polyclonal Anti-SLIT1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLIT1 |
Rabbit Polyclonal Anti-SLIT1 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLIT1 antibody: synthetic peptide directed towards the middle region of human SLIT1. Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC |