Antibodies

Jump to Filters
View as table Download
WNT2 Rabbit Polyclonal Antibody
TA351948

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2
WNT5A Rabbit Polyclonal Antibody
TA329908

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
Endothelin 1 (EDN1) (Center) Rabbit Polyclonal Antibody
AP51364PU-N

USD 580.00

2 Weeks

Endothelin 1 (EDN1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 111-138 amino acids from the Central region of human EDN1
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-N

USD 430.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated