Antibodies

View as table Download

Anti-ARNTL (BMAL1) mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARNTL (BMAL1) mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CRY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF

ARNTL (BMAL1) mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR1D1