FOXP3 mouse monoclonal antibody,clone UMAB248
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FOXP3 mouse monoclonal antibody,clone UMAB248
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone UMAB248
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI3D1
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FOXP3 mouse monoclonal antibody,clone OTI3D1
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
FOXP3 mouse monoclonal antibody,clone OTI3D1, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FOXP3 mouse monoclonal antibody,clone OTI3D1, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal FoxP3 Antibody
Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A peptide corresponding to amino acids 43-100 of mouse FOXP3. [Swiss-Prot# Q99JB6] |
Rabbit Polyclonal FOXP3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
FOXP3 mouse monoclonal antibody,clone UMAB248
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FOXP3 mouse monoclonal antibody,clone OTI3D1
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FOXP3 Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the C-terminal region of human FOXP3. AA range:381-430 |
Rabbit Polyclonal Anti-FOXP3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL |
FOXP3 mouse monoclonal antibody, clone SPM579, Purified
Applications | FC, IF, IHC |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
FOXP3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 290~319 amino acids from the C-terminal region of Human FOXP3. |
FOXP3 mouse monoclonal antibody, clone SPM579, Purified
Applications | FC, IF, IHC |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |