Antibodies

View as table Download

Anti-FABP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG