ACSL5 mouse monoclonal antibody,clone OTI3A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ACSL5 mouse monoclonal antibody,clone OTI3A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI3A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
ACSL5 mouse monoclonal antibody,clone OTI3A3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ACSL5 mouse monoclonal antibody,clone OTI3A3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-ACSL5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG |
ACSL5 mouse monoclonal antibody,clone OTI3A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".