Antibodies

View as table Download

Rabbit Polyclonal Anti-APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human APOBEC3G

Goat Anti-APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEHSQDLSGRLR, from the C Terminus of the protein sequence according to NP_068594.1.

APOBEC3G rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human APOBEC3G

APOBEC3G Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-330 of human APOBEC3G (NP_068594.1).
Modifications Unmodified

Rabbit Polyclonal APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen APOBEC3G antibody was raised against a synthetic peptide corresponding to 15 amino acids near the amino-terminus of human APOBEC3G APOBEC3G antibody will also detect the APOBEC3F isoform.

Rabbit Polyclonal Anti-APOBEC3G Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APOBEC3G Antibody: synthetic peptide directed towards the N terminal of human APOBEC3G. Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Goat Anti-APOBEC3G / ARP9 Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SKWRKLHRDQE, from the internal region of the protein sequence according to NP_068594.1