Antibodies

View as table Download

Rabbit Polyclonal Anti-TFDP2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-TFDP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TFDP2 Antibody: synthetic peptide directed towards the N terminal of human TFDP2. Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF