Antibodies

Jump to Filters
View as table Download
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF806473

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA806473AM

USD 509.00

2 Weeks

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA806473BM

USD 509.00

2 Weeks

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
TA338505

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody [Clone ID: OTI1G5]
CF806598

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]
TA806598AM

USD 509.00

2 Weeks

GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody
TA350008

USD 380.00

In Stock

Rabbit Polyclonal Anti-GABRB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GABRB1
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA351205

USD 380.00

In Stock

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA1