Antibodies

View as table Download

OTX2 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-OTX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

OTX2 mouse monoclonal antibody,clone OTI2B3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody,clone OTI2B3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

OTX2 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".