Antibodies

Jump to Filters
View as table Download
SMC3 Rabbit Polyclonal Antibody
TA342433

USD 539.00

5 Days

Rabbit Polyclonal Anti-SMC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMC3 antibody: synthetic peptide directed towards the C terminal of human SMC3. Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV