Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit polyclonal CDC25A (Ser75) antibody(Phospho-specific)
| Applications | IHC, WB |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of Ser75 |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K). |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Applications
- IHC
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Phosphatase
Pathways
- Cell cycle