Antibodies

Jump to Filters
View as table Download
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA308162

USD 625.00

In Stock

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)
Arginase 1 (ARG1) (1-145) Rabbit Polyclonal Antibody
AP23580PU-N

USD 535.00

2 Weeks

Arginase 1 (ARG1) (1-145) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 145 of Human Arginase-1
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338396

USD 485.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338397

USD 485.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Arginase 1 (ARG1) Goat Polyclonal Antibody
TA303209

USD 520.00

5 Days

Goat Polyclonal Antibody against ARG1

Applications IHC, PEP-ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-REGNHKPIDYLNPPK, from the C Terminus of the protein sequence according to NP_000036.2.