Antibodies

View as table Download

Rabbit Polyclonal Anti-IRF6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IRF6

Goat Polyclonal Antibody against IRF6

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-TPSMQLPPALPPQ, from the C Terminus of the protein sequence according to NP_006138.

Rabbit Polyclonal Anti-IRF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6. Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ