Rabbit Polyclonal Anti-RALY Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RALY Antibody: synthetic peptide directed towards the C terminal of human RALY. Synthetic peptide located within the following region: GGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDT |
Rabbit Polyclonal Anti-RALY Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RALY antibody: synthetic peptide directed towards the N terminal of human RALY. Synthetic peptide located within the following region: NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ |
Germany
Japan
United Kingdom
China
