Antibodies

Jump to Filters
View as table Download
Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]
TA503099

USD 447.00

In Stock

SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]
TA503099S

USD 200.00

In Stock

SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GCLM Rabbit Polyclonal Antibody
TA335034

USD 539.00

5 Days

Rabbit Polyclonal Anti-GCLM Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ