Rabbit Polyclonal antibody to USP15 (ubiquitin specific peptidase 15)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 920 and 981 of USP15 (Uniprot ID#Q9Y4E8) |
Rabbit Polyclonal Anti-USP15 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP15 antibody: synthetic peptide directed towards the C terminal of human USP15. Synthetic peptide located within the following region: GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED |
Germany
Japan
United Kingdom
China
