Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
Conjugation | Unconjugated |
Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Neurokinin 1 Receptor Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Guinea Pig, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the N-terminus of human NK-1 sequence conjugated to KLH. |