Antibodies

Jump to Filters
View as table Download
p53 (TP53) Mouse Monoclonal Antibody [Clone ID: Pab 240]
TA336582

USD 550.00

5 Days

Mouse Monoclonal p53 Antibody (PAb 240)

Applications CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Yeast (Does not react with: Xenopus)
Conjugation Unconjugated
beta Catenin (CTNNB1) Mouse Monoclonal Capture Antibody [Clone ID: OTI2H3]
TA600035

USD 458.00

In Stock

CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700034, TA700035
beta Catenin (CTNNB1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI6E7]
TA700035

USD 494.00

In Stock

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600035, TA600047, TA600141
beta Catenin (CTNNB1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI12C1]
TA700034

USD 494.00

In Stock

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600035, TA600034
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
beta Catenin (CTNNB1) Mouse Monoclonal Capture Antibody [Clone ID: OTI1B11]
TA600141

USD 458.00

In Stock

CTNNB1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700035
GLI1 Rabbit Polyclonal Antibody
TA309674

USD 605.00

5 Days

Rabbit Polyclonal Gli1 Antibody

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made toward the C-terminus portion of the human Gli1 protein (between residues 800-850) [UniProt P08151]
p53 (TP53) (Wild type + Mutant) (20-31) Mouse Monoclonal Antibody [Clone ID: Bp53-11]
AM09102PU-N

USD 425.00

2 Weeks

p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
beta Catenin (CTNNB1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI12H7]
TA700047

USD 494.00

2 Weeks

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600047