Antibodies

Jump to Filters
View as table Download
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
TA335177

USD 539.00

5 Days

Rabbit Polyclonal Anti-THRB Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK