Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TNFAIP3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFAIP3 |
TNFAIP3 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TNFAIP3 (NP_006281.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-TNFAIP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFAIP3 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFAIP3. Synthetic peptide located within the following region: QENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHE |
TNFAIP3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP |
Active filters
Target Symbol
- TNFAIP3
Antibody Hosts
- Rabbit