Rabbit Polyclonal Anti-C21orf66 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C21orf66 antibody: synthetic peptide directed towards the N terminal of human C21orf66. Synthetic peptide located within the following region: PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDE |
Rabbit Polyclonal Anti-C21orf66 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C21orf66 antibody: synthetic peptide directed towards the C terminal of human C21orf66. Synthetic peptide located within the following region: IGCSDVEKRNARENIKQIVKLLASVRALDHAMSVASDHNVKEFKSLIEGK |
PAXBP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GCFC1 |
Germany
Japan
United Kingdom
China