Antibodies

Jump to Filters
View as table Download
MARK3 Rabbit Polyclonal Antibody
TA372333

USD 380.00

4 Weeks

MARK3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MARK3
MARK3 Rabbit Polyclonal Antibody
TA311991

USD 380.00

In Stock

Rabbit polyclonal anti-MARK3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human MARK3.
MARK3 Rabbit Polyclonal Antibody
TA337660

USD 539.00

5 Days

Rabbit Polyclonal Anti-MARK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MARK3 antibody: synthetic peptide directed towards the middle region of human MARK3. Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD
MARK3 Rabbit Polyclonal Antibody
TA368096

USD 380.00

4 Weeks

MARK3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MARK3
MARK3 Rabbit Polyclonal Antibody
TA392743

USD 325.00

3 Weeks

c-TAK1 (P8) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminal of Human c-TAK1.
MARK3 Rabbit Polyclonal Antibody
TA378345

USD 365.00

3 Weeks

MARK3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MARK3.
Modifications Unmodified