Antibodies

Jump to Filters
View as table Download
Glypican 4 (GPC4) Rabbit Polyclonal Antibody
TA316797

USD 515.00

5 Days

GPC4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gorilla, Human, Mouse, Rat, Gibbon, Hamster (Predicted: Monkey, Dog, Rabbit)
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Bat, Hamster (100%); Marmoset, Dog, Elephant, Panda, Rabbit (94%); Bovine, Horse, Pig (88%).
Glypican 4 (GPC4) Rabbit Polyclonal Antibody
TA316798

USD 515.00

5 Days

GPC4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human (Predicted: Monkey, Rabbit)
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Rabbit (94%); Mouse, Rat, Bovine, Panda (88%); Hamster, Horse (81%).
Glypican 4 (GPC4) Rabbit Polyclonal Antibody
TA316796

USD 515.00

5 Days

GPC4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Dog, Gorilla, Human, Pig, Gibbon, Hamster (Predicted: Monkey, Mouse, Bovine, Horse)
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Pig (100%); Marmoset, Mouse, Elephant, Bovine, Horse (94%); Rat, Bat, Rabbit (88%).
Glypican 4 (GPC4) Rabbit Polyclonal Antibody
TA338271

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC4 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC4. Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ