Antibodies

Jump to Filters
View as table Download
ZUP1 Rabbit Polyclonal Antibody
TA365412

USD 380.00

4 Weeks

ZUP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ZUP1
ZUP1 (N-term) Rabbit Polyclonal Antibody
AP54742PU-N

USD 580.00

2 Weeks

ZUP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human ZUFSP
ZUP1 Rabbit Polyclonal Antibody
TA345514

USD 539.00

5 Days

Rabbit Polyclonal Anti-C6orf113 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C6orf113 antibody: synthetic peptide directed towards the C terminal of human C6orf113. Synthetic peptide located within the following region: LCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEG
ZUP1 Rabbit Polyclonal Antibody
TA330227

USD 539.00

5 Days

Rabbit Polyclonal Anti-C6orf113 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C6orf113 antibody: synthetic peptide directed towards the middle region of human C6orf113. Synthetic peptide located within the following region: RQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRMPPSEFHRRKAD