Antibodies

View as table Download

Rabbit polyclonal antibody to TPRKB (TP53RK binding protein)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 175 of TPRKB (Uniprot ID#Q9Y3C4)

Rabbit Polyclonal Anti-TPRKB Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPRKB antibody: synthetic peptide directed towards the middle region of human TPRKB. Synthetic peptide located within the following region: EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS

TPRKB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TPRKB