Rabbit Polyclonal Anti-H2AFJ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2AFJ antibody is: synthetic peptide directed towards the C-terminal region of Human H2AFJ. Synthetic peptide located within the following region: IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK |
Rabbit Polyclonal Anti-H2AFJ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2AFJ antibody is: synthetic peptide directed towards the N-terminal region of Human H2AFJ. Synthetic peptide located within the following region: AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE |
Germany
Japan
United Kingdom
China