Rabbit Polyclonal Anti-CHRNE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNE antibody: synthetic peptide directed towards the N terminal of human CHRNE. Synthetic peptide located within the following region: GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS |
CHRNE rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the human CHRNE protein. |
CHRNE Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human CHRNE (NP_000071.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China