Antibodies

Jump to Filters
View as table Download
ALDH9A1 Rabbit Polyclonal Antibody
TA323584

USD 380.00

In Stock

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1
ALDH9A1 Rabbit Polyclonal Antibody
TA323585

USD 380.00

In Stock

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1
ALDH9A1 Rabbit Polyclonal Antibody
TA342665

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH9A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC
ALDH9A1 Rabbit Polyclonal Antibody
TA890045

USD 407.00

In Stock

Rabbit polyclonal anti-ALDH9A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH9A1
ALDH9A1 (N-term) Rabbit Polyclonal Antibody
AP14688PU-N

USD 580.00

3 Days

ALDH9A1 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 4-34 amino acids from the N-terminal region of Human ALDH9A1.
ALDH9A1 (C-term) Rabbit Polyclonal Antibody
AP14689PU-N

USD 580.00

2 Weeks

ALDH9A1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human ALDH9A1.
ALDH9A1 Rabbit Polyclonal Antibody
TA890045S

USD 188.00

2 Days

Rabbit polyclonal anti-ALDH9A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH9A1

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALDH9A1 Rabbit Polyclonal Antibody
TA373449

USD 365.00

3 Weeks

ALDH9A1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ALDH9A1
Modifications Unmodified
ALDH9A1 Rabbit Polyclonal Antibody
TA359579

USD 539.00

5 Days

ALDH9A1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human AL9A1